PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C019904P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 234aa    MW: 26431.5 Da    PI: 8.0467
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C019904P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.24.4e-091659344
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                      WT  Ed+l+ +a    + +   +W ++a +++ g+++ ++k+++
   MELO3C019904P1 16 HWTRSEDKLFEEALVVVPANlpdRWQRVADHVP-GKSPREVKDHY 59
                     5*****************99*************.**********9 PP

2Myb_DNA-binding44.43.8e-14115159347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + k++G+g+W++I+r +  +Rt+ q+ s+ qky
   MELO3C019904P1 115 PWTEEEHRLFLLGLKKFGKGDWRSISRNVVITRTPTQVASHAQKY 159
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.96E-12964IPR009057Homeodomain-like
PROSITE profilePS512949.013967IPR017930Myb domain
SMARTSM007172.3E-81365IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.9E-61562IPR009057Homeodomain-like
PfamPF002491.3E-71660IPR001005SANT/Myb domain
CDDcd001674.83E-81763No hitNo description
PROSITE profilePS5129420.748108164IPR017930Myb domain
SuperFamilySSF466891.15E-16110164IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-17111163IPR006447Myb domain, plants
SMARTSM007171.6E-12112162IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-11112158IPR009057Homeodomain-like
CDDcd001671.07E-10115160No hitNo description
PfamPF002491.0E-12115159IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MFHDSRWTTM TQSSTHWTRS EDKLFEEALV VVPANLPDRW QRVADHVPGK SPREVKDHYE  60
ALVHDVLEID SGRVELPSYA EESAVGLPEW DSSGQISFGS KAKHGGDNER KKGTPWTEEE  120
HRLFLLGLKK FGKGDWRSIS RNVVITRTPT QVASHAQKYF LRQTSGKKER KRSSIHDITT  180
VDNNSIPMPI DPNWISPAPN NPTIQSTMQQ LSPTSHGQDQ GASLGFQNYR FPM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-1517791173RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818210.0LN681821.1 Cucumis melo genomic scaffold, anchoredscaffold00040.
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008456608.11e-175PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H72e-63DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0A0KE731e-172A0A0A0KE73_CUCSA; Syringolide-induced protein 1-3-1B
STRINGGLYMA20G24600.11e-106(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.11e-69MYB family protein